DOG-1 / TMEM16A (Marker for Gastrointestinal Stromal Tumors); Clone DG1/447 & DOG-1.1, Concentrate, 0.5 mL
Sale!

DOG-1 / TMEM16A (Marker for Gastrointestinal Stromal Tumors); Clone DG1/447 & DOG-1.1, Concentrate, 0.5 mL

Original price was: $346.61.Current price is: $69.32.

SKU: CP-RA0364-C.5 Category:

Description

Description

DOG-1 / TMEM16A (Marker for Gastrointestinal Stromal Tumors); Clone DG1/447 & DOG-1.1 (Concentrate), 0.5 mL.

  • Species: Mouse
  • Immunogen: Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).
  • Clone: DG1/447 & DOG-1.1
  • Isotype: IgG1, kappa (DG1/447 & DOG-1.1)
  • Species Reactivity: Human. Others not known.
  • Positive Control: Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.

Specificity: This monoclonal antibody recognizes Human DOG1. It is a sensitive and specific immunohistochemical marker for GIST, comparable with c-Kit, with the additional benefit of detecting c-Kit-negative GISTs. It is also a sensitive marker for unusual GIST subgroups lacking c-Kit or PDGFRA mutations. Status: RUO.

  • Volume: 0.5 mL
  • Storage: 2°C- 8°C
  • Download: Instructions For Use
  • MSDS: Material Safety Data Sheet

Antibodies> Research Antibodies> Monoclonal Concentrate

Contact us for bulk order inquiries, custom packaging, blanket orders, and other special orders.

Terms & Conditions

These chemicals are for professional manufacturing, research laboratories and industrial / commercial usage only. Not for medical or consumer use. We currently cannot ship this product to doctor offices, pharmacies, medical facilities, veterinarians or residences. All orders are verified prior to shipment. Orders shipping to consumers or medical facilities will be canceled.

Please note: This product is not returnable. Chemicals cannot be expedited.

Reviews

There are no reviews yet.

Be the first to review “DOG-1 / TMEM16A (Marker for Gastrointestinal Stromal Tumors); Clone DG1/447 & DOG-1.1, Concentrate, 0.5 mL”

Your email address will not be published. Required fields are marked *